3t7y/1/1:A/1:B

Sequences

>3t7y-a1-m1-cA (length=94) [Search sequence]

TSSQIKHASAVVSAPKDIAVAIGYMPEKYKAPWIIAMGVNLRAKRIIAEAEKYGVPIMRN VPLAHQLLDEGKELKFIPETTYEAVGEILLYITS

>3t7y-a1-m1-cB (length=94) [Search sequence]

TSSQIKHASAVVSAPKDIAVAIGYMPEKYKAPWIIAMGVNLRAKRIIAEAEKYGVPIMRN VPLAHQLLDEGKELKFIPETTYEAVGEILLYITS

Structure information

PDB ID	3t7y (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of an autocleavage-inactive mutant of the cytoplasmic domain of CT091, the YscU homologue of Chlamydia trachomatis
Assembly ID	1
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	36
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	O84093	O84093
Species	813 (Chlamydia trachomatis)	813 (Chlamydia trachomatis)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3t7y-a1-m1-cA_3t7y-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3t7y-assembly1.cif.gz