3t97/1/1:C/1:A

Sequences
>3t97-a1-m1-cC (length=54) [Search sequence]
WDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESV
>3t97-a1-m1-cA (length=56) [Search sequence]
WDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKE
Structure information
PDB ID 3t97 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Molecular Architecture of the Transport Channel of the Nuclear Pore Complex: Nup62/Nup54
Assembly ID 1
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 57
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C A
UniProt accession P17955 P17955
Species 10116 (Rattus norvegicus) 10116 (Rattus norvegicus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3t97-a1-m1-cC_3t97-a1-m1-cA.pdb.gz
Full biological assembly
Download: 3t97-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5h1x/1/1:C/1:A 5h1x/1/1:C/1:B

[Back to Home]