3ta2/2/4:B/5:B

Sequences
>3ta2-a2-m4-cB (length=109) [Search sequence]
MKMVVAVIRPEKLECVKKALEERGFVGMTVTEVKGRGEQKGIRLQFRGREVEVDLLQKTK
VEVVVSDDAVDEVVEAIVSSARTGKFGDGRIFVIPVEKSVKIRTGDEEV
>3ta2-a2-m5-cB (length=109) [Search sequence]
MKMVVAVIRPEKLECVKKALEERGFVGMTVTEVKGRGEQKGIRLQFRGREVEVDLLQKTK
VEVVVSDDAVDEVVEAIVSSARTGKFGDGRIFVIPVEKSVKIRTGDEEV
Structure information
PDB ID 3ta2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title A. fulgidus GlnK3, MgATP/2-OG complex
Assembly ID 2
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 81
Sequence identity between the two chains 1.0
PubMed citation 22039461
Chain information
Chain 1 Chain 2
Model ID 4 5
Chain ID B B
UniProt accession O28524 O28524
Species 224325 (Archaeoglobus fulgidus DSM 4304) 224325 (Archaeoglobus fulgidus DSM 4304)
Function annotation BioLiP:3ta2B BioLiP:3ta2B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3ta2-a2-m4-cB_3ta2-a2-m5-cB.pdb.gz
Full biological assembly
Download: 3ta2-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3o8w/1/1:A/2:A 3o8w/1/1:A/3:A 3o8w/1/2:A/3:A 3ta1/1/1:A/1:D 3ta1/1/1:C/1:A 3ta1/1/1:C/1:D 3ta1/2/1:B/1:F 3ta1/2/1:E/1:B 3ta1/2/1:E/1:F 3ta2/1/1:A/2:A 3ta2/1/1:A/3:A 3ta2/1/2:A/3:A 3ta2/2/1:B/4:B 3ta2/2/1:B/5:B 3ta2/3/1:C/6:C 3ta2/3/1:C/7:C 3ta2/3/6:C/7:C

[Back to Home]