3tbm/1/1:A/1:B

Sequences
>3tbm-a1-m1-cA (length=61) [Search sequence]
VVITARNNGPYHIKGSFRIVTQGGRELPVEQGQAWLCRCGHSLNKPFCDGSHKRVEFDSN
L
>3tbm-a1-m1-cB (length=61) [Search sequence]
VVITARNNGPYHIKGSFRIVTQGGRELPVEQGQAWLCRCGHSLNKPFCDGSHKRVEFDSN
L
Structure information
PDB ID 3tbm (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a type 4 CDGSH iron-sulfur protein.
Assembly ID 1
Resolution 1.797Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 98
Sequence identity between the two chains 1.0
PubMed citation 21949752
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q8XVB9 Q8XVB9
Species 267608 (Ralstonia pseudosolanacearum GMI1000) 267608 (Ralstonia pseudosolanacearum GMI1000)
Function annotation BioLiP:3tbmA BioLiP:3tbmB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3tbm-a1-m1-cA_3tbm-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3tbm-assembly1.cif.gz

[Back to Home]