3td3/3/1:E/1:H

Sequences
>3td3-a3-m1-cE (length=120) [Search sequence]
MELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLN
ERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR
>3td3-a3-m1-cH (length=121) [Search sequence]
HMELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKL
NERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGS
R
Structure information
PDB ID 3td3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of OmpA-like domain from Acinetobacter baumannii in complex with glycine
Assembly ID 3
Resolution 1.59Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 53
Sequence identity between the two chains 1.0
PubMed citation 21965596
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E H
UniProt accession Q6RYW5 Q6RYW5
Species 470 (Acinetobacter baumannii) 470 (Acinetobacter baumannii)
Function annotation BioLiP:3td3E BioLiP:3td3H
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3td3-a3-m1-cE_3td3-a3-m1-cH.pdb.gz
Full biological assembly
Download: 3td3-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3td3/1/1:A/1:C 3td3/2/1:B/1:D 3td3/4/1:F/1:G 3td4/1/1:C/1:A 3td4/2/1:D/1:B 3td4/3/1:E/1:H 3td4/4/1:F/1:G 3td5/1/1:A/1:B 3td5/2/1:C/1:D 3td5/3/1:E/1:F 3td5/4/1:G/1:H 4g4y/1/1:A/1:C 4g4y/2/1:B/1:D 4g4y/3/1:E/1:H 4g4y/4/1:F/1:G 4g4z/1/1:C/1:A 4g4z/2/1:B/1:D 4g4z/3/1:E/1:H 4g4z/4/1:F/1:G 4g88/1/1:C/1:A 4g88/2/1:B/1:D 4g88/3/1:E/1:H 4g88/4/1:F/1:G

[Back to Home]