3tfx/1/1:B/1:A

Sequences

>3tfx-a1-m1-cB (length=218) [Search sequence]

DRPVIVALDLDNEEQLNKILSKLGDPHDVFVKVGELFYNAGIDVIKKLTQQGYKIFLDLK
HDIPNTVYNGAKALAKLGITFTTVHALGGSQIKSAKDGLIAGTPAGHSVPKLLAVTELTS
ISDDVLRNEQNCRLPAEQVLSLAKAKHSGADGVICSPLEVKKLHENIGDDFLYVTPGIRP
ATPKAKEWGSSAIVVGRPITLASDPKAAYEAIKKEFNA

>3tfx-a1-m1-cA (length=225) [Search sequence]

Structure information

PDB ID	3tfx (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Orotidine 5'-phosphate decarboxylase from Lactobacillus acidophilus
Assembly ID	1
Resolution	2.19Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	103
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q5FJB3	Q5FJB3
Species	1579 (Lactobacillus acidophilus)	1579 (Lactobacillus acidophilus)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3tfx-a1-m1-cB_3tfx-a1-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3tfx-assembly1.cif.gz