3tmh/1/1:E/2:I

Sequences

>3tmh-a1-m1-cE (length=82) [Search sequence]

KPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDE PYEKVVDRIQSSGKNVTLLVCG

>3tmh-a1-m2-cI (length=82) [Search sequence]

KPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDE PYEKVVDRIQSSGKNVTLLVCG

Structure information

PDB ID	3tmh (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of dual-specific A-kinase anchoring protein 2 in complex with cAMP-dependent protein kinase A type II alpha and PDZK1
Assembly ID	1
Resolution	3.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	12
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	E	I
UniProt accession	Q5T2W1	Q5T2W1
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:3tmhE	BioLiP:3tmhI

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3tmh-a1-m1-cE_3tmh-a1-m2-cI.pdb.gz

Full biological assembly Download: 3tmh-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3tmh/1/1:A/1:E 3tmh/1/1:A/2:I 3tmh/1/1:I/2:A 3tmh/1/1:I/2:E 3tmh/1/2:A/2:E