3tom/3/1:C/1:D

Sequences
>3tom-a3-m1-cC (length=106) [Search sequence]
ADLEDNMETLNDNLKVIEKADNAAQVEKALEKMLAAAADALKATPPKLEDKSPDSPEMRD
FRHGFAILMGQIHDAAHLANEGKVKEAQAAAEQLKTTCNACHQKYR
>3tom-a3-m1-cD (length=106) [Search sequence]
ADLEDNMETLNDNLKVIEKADNAAQVEKALEKMLAAAADALKATPPKLEDKSPDSPEMRD
FRHGFAILMGQIHDAAHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Structure information
PDB ID 3tom (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of an engineered cytochrome cb562 that forms 2D, Zn-mediated sheets
Assembly ID 3
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 42
Sequence identity between the two chains 1.0
PubMed citation 22522257
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession P0ABE7 P0ABE7
Species 562 (Escherichia coli) 562 (Escherichia coli)
Function annotation BioLiP:3tomC BioLiP:3tomD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3tom-a3-m1-cC_3tom-a3-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3tom-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3tol/1/1:A/1:B 3tol/2/1:C/1:D 3tom/1/1:C/1:D 3tom/2/1:A/1:B 3tom/3/1:A/1:B 5bu7/1/1:A/1:B 5bu7/1/2:A/2:B
Other dimers with similar sequences but different poses
  • 5bu7/1/1:B/2:B 5bu7/1/1:A/2:A
  • 5bu7/1/1:A/2:B 5bu7/1/1:B/2:A
    		•

    [Back to Home]