3tos/8/1:H/1:J

Sequences

>3tos-a8-m1-cH (length=247) [Search sequence]

QDLRAFVHDSPEETETTQRLTKLLTNSPIPTEELVNNLPLFLRRHQTDLLSDALYRQVLD
VPGVIEFGVRFGRHLGTFAALRGVYEPYNPLRRIVGFDTFTGFPDVNDVDRVGPTAYQGR
FAVPGGYPAYLKEVLDAHECSDFFGHVTQRSVLVEGDVRETVPRYLAENPQTVIALAYFD
LDLYEPTKAVLEAIRPYLTKGSIVAFDELDNPKWPGENIARKVLGLDHAPLRLLPGRPAP
AYLRWGD

>3tos-a8-m1-cJ (length=247) [Search sequence]

Structure information

PDB ID	3tos (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of CalS11, Calicheamicin Methyltransferase
Assembly ID	8
Resolution	1.55Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	170
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	H	J
UniProt accession	Q8KNF1	Q8KNF1
Species	1877 (Micromonospora echinospora)	1877 (Micromonospora echinospora)
Function annotation	BioLiP:3tosH	BioLiP:3tosJ

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3tos-a8-m1-cH_3tos-a8-m1-cJ.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3tos-assembly8.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3tos/1/1:A/1:D 3tos/1/1:C/1:B 3tos/1/1:E/1:I 3tos/1/1:F/1:G 3tos/1/1:H/1:J 3tos/2/1:A/1:D 3tos/2/1:C/1:B 3tos/2/1:E/1:I 3tos/2/1:F/1:G 3tos/2/1:H/1:J 3tos/3/1:A/1:D 3tos/3/1:E/1:I 3tos/4/1:A/1:D 3tos/4/1:C/1:B 3tos/4/1:E/1:I 3tos/4/1:F/1:G 3tos/4/1:H/1:J 3tos/5/1:C/1:B 3tos/5/1:E/1:I 3tos/5/1:H/1:J 3tos/6/1:E/1:I 3tos/6/1:F/1:G 3tos/7/1:F/1:G 3tos/7/1:H/1:J 3tos/8/1:C/1:B 3tos/8/1:F/1:G 4gf5/1/1:A/1:J 4gf5/1/1:B/1:H 4gf5/1/1:C/1:G 4gf5/1/1:D/1:E 4gf5/1/1:F/1:I 4gf5/2/1:K/1:Q 4gf5/2/1:L/1:P 4gf5/2/1:M/1:R 4gf5/2/1:N/1:T 4gf5/2/1:O/1:S 5hoq/1/1:B/1:E 5hoq/1/1:C/2:C 5hoq/1/1:D/1:A 5hoq/1/2:B/2:E 5hoq/1/2:D/2:A

Other dimers with similar sequences but different poses

3tos/8/1:D/1:J 3tos/1/1:A/1:C 3tos/1/1:A/1:H 3tos/1/1:C/1:F 3tos/1/1:D/1:B 3tos/1/1:D/1:J 3tos/1/1:E/1:F 3tos/1/1:E/1:H 3tos/1/1:G/1:B 3tos/1/1:I/1:G 3tos/1/1:I/1:J 3tos/2/1:A/1:C 3tos/2/1:A/1:H 3tos/2/1:C/1:F 3tos/2/1:D/1:B 3tos/2/1:D/1:J 3tos/2/1:E/1:F 3tos/2/1:E/1:H 3tos/2/1:G/1:B 3tos/2/1:I/1:G 3tos/2/1:I/1:J 3tos/3/1:A/1:C 3tos/3/1:A/1:H 3tos/3/1:C/1:F 3tos/3/1:E/1:F 3tos/3/1:E/1:H 3tos/4/1:A/1:C 3tos/4/1:A/1:H 3tos/4/1:C/1:F 3tos/4/1:D/1:B 3tos/4/1:D/1:J 3tos/4/1:E/1:F 3tos/4/1:E/1:H 3tos/4/1:G/1:B 3tos/4/1:I/1:G 3tos/4/1:I/1:J 3tos/5/1:A/1:C 3tos/5/1:A/1:H 3tos/5/1:E/1:H 3tos/5/1:I/1:J 3tos/6/1:D/1:B 3tos/6/1:D/1:J 3tos/6/1:E/1:F 3tos/6/1:G/1:B 3tos/6/1:I/1:G 3tos/6/1:I/1:J 3tos/7/1:D/1:B 3tos/7/1:D/1:J 3tos/7/1:G/1:B 3tos/8/1:C/1:F 3tos/8/1:D/1:B 3tos/8/1:E/1:F 3tos/8/1:E/1:H 3tos/8/1:G/1:B 4gf5/1/1:A/1:C 4gf5/1/1:A/1:H 4gf5/1/1:B/1:D 4gf5/1/1:B/1:J 4gf5/1/1:C/1:F 4gf5/1/1:D/1:I 4gf5/1/1:E/1:F 4gf5/1/1:E/1:H 4gf5/1/1:G/1:I 4gf5/1/1:G/1:J 4gf5/2/1:K/1:L 4gf5/2/1:K/1:O 4gf5/2/1:L/1:N 4gf5/2/1:M/1:N 4gf5/2/1:M/1:O 4gf5/2/1:P/1:Q 4gf5/2/1:P/1:T 4gf5/2/1:Q/1:S 4gf5/2/1:R/1:S 4gf5/2/1:R/1:T 5hoq/1/1:A/1:E 5hoq/1/1:B/1:D 5hoq/1/1:C/1:E 5hoq/1/1:C/2:B 5hoq/1/1:D/2:A 5hoq/1/2:A/2:E 5hoq/1/2:B/2:D 5hoq/1/2:C/1:B 5hoq/1/2:C/2:E 5hoq/1/2:D/1:A