3tpw/1/2:A/3:A

Sequences

>3tpw-a1-m2-cA (length=114) [Search sequence]

QKQPISKLTRATPGSAGLDLCSTSHTVLTPEMGPQALSTGIYGPLPPNTFGLILGRSSIT MKGLQVYPGVIDNDYTGEIKIMAKAVNNIVTVSQGNRIAQLILLPLIETDNKVQ

>3tpw-a1-m3-cA (length=114) [Search sequence]

QKQPISKLTRATPGSAGLDLCSTSHTVLTPEMGPQALSTGIYGPLPPNTFGLILGRSSIT MKGLQVYPGVIDNDYTGEIKIMAKAVNNIVTVSQGNRIAQLILLPLIETDNKVQ

Structure information

PDB ID	3tpw (database links: RCSB PDB PDBe PDBj PDBsum)
Title	CRYSTAL STRUCTURE OF M-PMV DUTPASE - DUPNPP complex revealing distorted ligand geometry (approach intermediate)
Assembly ID	1
Resolution	1.65Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	78
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	2	3
Chain ID	A	A
UniProt accession	P07570	P07570
Species	11855 (Mason-Pfizer monkey virus)	11855 (Mason-Pfizer monkey virus)
Function annotation	BioLiP:3tpwA	BioLiP:3tpwA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3tpw-a1-m2-cA_3tpw-a1-m3-cA.pdb.gz

Full biological assembly Download: 3tpw-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2d4l/1/1:A/2:A 2d4l/1/1:A/3:A 2d4l/1/2:A/3:A 2d4m/1/1:A/2:A 2d4m/1/1:A/3:A 2d4m/1/2:A/3:A 2d4n/1/1:A/2:A 2d4n/1/1:A/3:A 2d4n/1/2:A/3:A 3tp1/1/1:A/2:A 3tp1/1/1:A/3:A 3tp1/1/2:A/3:A 3tpn/1/1:A/2:A 3tpn/1/1:A/3:A 3tpn/1/2:A/3:A 3tps/1/1:A/2:A 3tps/1/1:A/3:A 3tps/1/2:A/3:A 3tpw/1/1:A/2:A 3tpw/1/1:A/3:A 3tpy/1/1:A/2:A 3tpy/1/1:A/3:A 3tpy/1/2:A/3:A 3tq3/1/1:A/2:A 3tq3/1/1:A/3:A 3tq3/1/2:A/3:A 3tq4/1/1:A/2:A 3tq4/1/1:A/3:A 3tq4/1/2:A/3:A 3tq5/1/1:A/2:A 3tq5/1/1:A/3:A 3tq5/1/2:A/3:A 3trl/1/1:A/2:A 3trl/1/1:A/3:A 3trl/1/2:A/3:A 3trn/1/1:A/2:A 3trn/1/1:A/3:A 3trn/1/2:A/3:A 3ts6/1/1:A/2:A 3ts6/1/1:A/3:A 3ts6/1/2:A/3:A 3tsl/1/1:A/2:A 3tsl/1/1:A/3:A 3tsl/1/2:A/3:A 3tta/1/1:A/2:A 3tta/1/1:A/3:A 3tta/1/2:A/3:A