3tsc/1/1:B/1:D

Sequences

>3tsc-a1-m1-cB (length=271) [Search sequence]

GKLEGRVAFITGAARGQGRAHAVRMAAEGADIIAVDIAGKLPSCVPYDPASPDDLSETVR
LVEAANRRIVAAVVDTRDFDRLRKVVDDGVAALGRLDIIVANAGVAAPQAWDDITPEDFR
DVMDINVTGTWNTVMAGAPRIIEGGRGGSIILISSAAGMKMQPFMIHYTASKHAVTGLAR
AFAAELGKHSIRVNSVHPGPVNTPMGSGDMVTAVGQAMETNPQLSHVLTPFLPDWVAEPE
DIADTVCWLASDESRKVTAAQIPVDQGSTQY

>3tsc-a1-m1-cD (length=271) [Search sequence]

Structure information

PDB ID	3tsc (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of short chain dehydrogenase MAP_2410 from Mycobacterium paratuberculosis bound to NAD
Assembly ID	1
Resolution	2.05Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	125
Sequence identity between the two chains	1.0
PubMed citation	28120876

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	D
UniProt accession	Q73X99	Q73X99
Species	1770 (Mycobacterium avium subsp. paratuberculosis)	1770 (Mycobacterium avium subsp. paratuberculosis)
Function annotation	BioLiP:3tscB	BioLiP:3tscD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3tsc-a1-m1-cB_3tsc-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3tsc-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

3tsc/1/1:C/1:D 3tsc/1/1:A/1:B

3tsc/1/1:A/1:D 3tsc/1/1:B/1:C