3tsi/1/1:A/1:C

Sequences
>3tsi-a1-m1-cA (length=50) [Search sequence]
SPSSGLGSITDLLNNILSVANQIIYNSAVALPLQLDTLESTLLTAIKSLQ
>3tsi-a1-m1-cC (length=50) [Search sequence]
SPSSGLGSITDLLNNILSVANQIIYNSAVALPLQLDTLESTLLTAIKSLQ
Structure information
PDB ID 3tsi (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the parainfluenza virus 5 (PIV5) hemagglutinin-neuraminidase (HN) stalk domain
Assembly ID 1
Resolution 2.651Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 57
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession P04850 P04850
Species 11208 (Simian virus 5 (strain W3)) 11208 (Simian virus 5 (strain W3))
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3tsi-a1-m1-cA_3tsi-a1-m1-cC.pdb.gz
Full biological assembly
Download: 3tsi-assembly1.cif.gz

[Back to Home]