3tth/14/2:H/2:J

Sequences
>3tth-a14-m2-cH (length=161) [Search sequence]
KKIRLSALEREDLKFVHELNNNLSSYWFEEPYESYRELEDLHIKHIHDQSERRFIIKDLK
DNKVGLVELTEIDFIHRRCEFAIIISPGEEGKGYATEATDLTVEYAFSILNLHKIYLLVD
EDNPAALHIYRKSGFAEEGKLVDEYYSKGRYRTAIRYVLKK
>3tth-a14-m2-cJ (length=162) [Search sequence]
KKIRLSALEREDLKFVHELNNNLSISYWFEEPYESYRELEDLHIKHIHDQSERRFIIKDL
KDNKVGLVELTEIDFIHRRCEFAIIISPGEEGKGYATEATDLTVEYAFSILNLHKIYLLV
DEDNPAALHIYRKSGFAEEGKLVDEYYSKGRYRTAIRYVLKK
Structure information
PDB ID 3tth (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the spermidine N1-acetyltransferase (speG) from Coxiella burnetii
Assembly ID 14
Resolution 3.298Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 29
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID H J
UniProt accession Q83B40 Q83B40
Species 777 (Coxiella burnetii) 777 (Coxiella burnetii)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3tth-a14-m2-cH_3tth-a14-m2-cJ.pdb.gz
Full biological assembly
Download: 3tth-assembly14.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3tth/13/1:A/1:C 3tth/13/1:A/2:E 3tth/13/1:C/1:E 3tth/13/1:D/1:B 3tth/13/1:D/1:F 3tth/13/1:F/2:B 3tth/13/2:A/1:E 3tth/13/2:A/2:C 3tth/13/2:C/2:E 3tth/13/2:D/2:B 3tth/13/2:D/2:F 3tth/13/2:F/1:B 3tth/14/1:H/1:J 3tth/14/1:I/1:G 3tth/14/1:I/1:K 3tth/14/1:K/2:G 3tth/14/1:L/1:J 3tth/14/1:L/2:H 3tth/14/2:I/2:G 3tth/14/2:I/2:K 3tth/14/2:K/1:G 3tth/14/2:L/1:H 3tth/14/2:L/2:J
Other dimers with similar sequences but different poses
  • 3tth/14/2:H/2:G 3tth/13/1:A/1:B 3tth/13/1:D/1:C 3tth/13/1:F/1:E 3tth/13/2:A/2:B 3tth/13/2:D/2:C 3tth/13/2:F/2:E 3tth/14/1:H/1:G 3tth/14/1:I/1:J 3tth/14/1:K/1:L 3tth/14/2:I/2:J 3tth/14/2:K/2:L
  • 3tth/14/2:K/2:J 3tth/13/1:A/2:F 3tth/13/1:C/1:B 3tth/13/1:D/1:E 3tth/13/1:F/2:A 3tth/13/2:C/2:B 3tth/13/2:D/2:E 3tth/14/1:I/1:H 3tth/14/1:K/1:J 3tth/14/2:I/2:H
    		•

    [Back to Home]