3tuo/1/1:D/1:A

Sequences

>3tuo-a1-m1-cD (length=91) [Search sequence]

GSGTMLPVFCVVEHYHAEFVLVRKDMLFNQLIEMALLSLGYSHSSAAQAKGLIQVGKWNP VPLSYVTDAPDATVADMLQDVYHVVTLKIQL

>3tuo-a1-m1-cA (length=104) [Search sequence]

PGSGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGYSHSSAAQ AKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLH

Structure information

PDB ID	3tuo (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of N-terminal domain of DNA-binding protein satb1
Assembly ID	1
Resolution	1.697Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	42
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	A
UniProt accession	Q01826	Q01826
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3tuo-a1-m1-cD_3tuo-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3tuo-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

3tuo/1/1:D/1:C 3tuo/1/1:B/1:A 4q2j/1/1:C/1:D