3twd/3/3:A/8:B

Sequences
>3twd-a3-m3-cA (length=222) [Search sequence]
ASRLERVYQSEQAEKLLLAGVMLRDPARFDLRGTLTHGRDVEIDTNVIIEGNVTLGHRVK
IGTGCVIKNSVIGDDCEISPYTVVEDANLAAACTIGPFARLRPGAELLEGAHVGNFVEMK
KARLGKGSKAGHLTYLGDAEIGDNVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVA
PVTVGKGATIAAGTTVTRNVGENALAISRVPQTQKEGWRRPA
>3twd-a3-m8-cB (length=222) [Search sequence]
ASRLERVYQSEQAEKLLLAGVMLRDPARFDLRGTLTHGRDVEIDTNVIIEGNVTLGHRVK
IGTGCVIKNSVIGDDCEISPYTVVEDANLAAACTIGPFARLRPGAELLEGAHVGNFVEMK
KARLGKGSKAGHLTYLGDAEIGDNVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVA
PVTVGKGATIAAGTTVTRNVGENALAISRVPQTQKEGWRRPA
Structure information
PDB ID 3twd (database links: RCSB PDB PDBe PDBj PDBsum)
Title glmuC1 in complex with an antibacterial inhibitor
Assembly ID 3
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
PubMed citation 21984832
Chain information
Chain 1 Chain 2
Model ID 3 8
Chain ID A B
UniProt accession P0ACC7 P0ACC7
Species 83333 (Escherichia coli K-12) 83333 (Escherichia coli K-12)
Function annotation BioLiP:3twdA BioLiP:3twdB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3twd-a3-m3-cA_3twd-a3-m8-cB.pdb.gz
Full biological assembly
Download: 3twd-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3twd/3/1:A/6:B 3twd/3/2:A/7:B
Other dimers with similar sequences but different poses
  • 2oi6/1/2:A/3:A 1fwy/1/1:A/2:A 1fwy/1/1:A/3:A 1fwy/1/2:A/3:A 1fwy/2/1:B/2:B 1fwy/2/1:B/3:B 1fwy/2/2:B/3:B 1fxj/1/1:A/2:A 1fxj/1/1:A/3:A 1fxj/1/2:A/3:A 1fxj/2/1:B/2:B 1fxj/2/1:B/3:B 1fxj/2/2:B/3:B 1hv9/1/1:A/2:A 1hv9/1/1:A/3:A 1hv9/1/2:A/3:A 2oi5/1/1:A/2:A 2oi5/1/1:A/3:A 2oi5/1/2:A/3:A 2oi6/1/1:A/2:A 2oi6/1/1:A/3:A 2oi7/1/1:A/2:A 2oi7/1/1:A/3:A 2oi7/1/2:A/3:A 2oi7/3/1:A/2:A 2oi7/3/1:A/3:A 2oi7/3/2:A/3:A 8cu9/1/1:A/2:A 8cu9/1/1:A/3:A 8cu9/1/2:A/3:A
  • 1hv9/2/2:B/3:B 1hv9/2/1:B/2:B 1hv9/2/1:B/3:B 2oi5/2/1:B/2:B 2oi5/2/1:B/3:B 2oi5/2/2:B/3:B 2oi6/2/1:B/2:B 2oi6/2/1:B/3:B 2oi6/2/2:B/3:B 2oi7/2/1:B/2:B 2oi7/2/1:B/3:B 2oi7/2/2:B/3:B 2oi7/3/1:B/2:B 2oi7/3/1:B/3:B 2oi7/3/2:B/3:B 3twd/1/1:A/2:A 3twd/1/1:A/3:A 3twd/1/2:A/3:A 3twd/2/1:B/4:B 3twd/2/1:B/5:B 3twd/2/4:B/5:B 3twd/3/1:A/2:A 3twd/3/1:A/3:A 3twd/3/2:A/3:A 3twd/3/6:B/7:B 3twd/3/6:B/8:B 3twd/3/7:B/8:B 4aa7/1/1:A/2:A 4aa7/1/1:A/3:A 4aa7/1/2:A/3:A 4aa7/2/1:B/4:B 4aa7/2/1:B/5:B 4aa7/2/4:B/5:B
  • [Back to Home]