3txs/1/3:D/3:B

Sequences

>3txs-a1-m3-cD (length=89) [Search sequence]

QVYAPLVLRDPVSNPNNRKIDQDDDYELVRRNMHYQSQMLLDMAKIALENAKNADSPRHV EVFAQLMGQMTTTNKEMLKMHKEMKDLAG

>3txs-a1-m3-cB (length=90) [Search sequence]

QVYAPLVLRDPVSNPNNRKIDQDDDYELVRRNMHYQSQMLLDMAKIALENAKNADSPRHV EVFAQLMGQMTTTNKEMLKMHKEMKDLAGA

Structure information

PDB ID	3txs (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of phage 44RR small terminase gp16
Assembly ID	1
Resolution	1.81Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	11
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	3	3
Chain ID	D	B
UniProt accession	Q6U9F0	Q6U9F0
Species	115987 (Biquartavirus 44RR2)	115987 (Biquartavirus 44RR2)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3txs-a1-m3-cD_3txs-a1-m3-cB.pdb.gz

Full biological assembly Download: 3txs-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3txs/1/1:A/1:C 3txs/1/1:A/2:C 3txs/1/1:D/1:B 3txs/1/2:A/2:C 3txs/1/2:A/3:C 3txs/1/2:D/2:B 3txs/1/3:A/1:C 3txs/1/3:A/3:C
Other dimers with similar sequences but different poses	3txq/1/1:A/1:K 3txq/1/1:A/1:C 3txq/1/1:B/1:H 3txq/1/1:B/1:I 3txq/1/1:C/1:E 3txq/1/1:D/1:G 3txq/1/1:D/1:J 3txq/1/1:E/1:F 3txq/1/1:F/1:G 3txq/1/1:H/1:K 3txq/1/1:I/1:J 3txs/1/1:A/1:B 3txs/1/1:A/2:D 3txs/1/1:B/1:C 3txs/1/1:D/1:C 3txs/1/1:D/3:A 3txs/1/2:A/2:B 3txs/1/2:A/3:D 3txs/1/2:B/2:C 3txs/1/2:D/2:C 3txs/1/3:A/3:B 3txs/1/3:B/3:C 3txs/1/3:D/3:C