3u39/1/1:B/1:C

Sequences

>3u39-a1-m1-cB (length=318) [Search sequence]

MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS
GLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEAL
ANKHTIDQRMYALSKELS

>3u39-a1-m1-cC (length=319) [Search sequence]

Structure information

PDB ID	3u39 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the apo Bacillus Stearothermophilus phosphofructokinase
Assembly ID	1
Resolution	2.7921Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	97
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	P00512	P00512
Species	1422 (Geobacillus stearothermophilus)	1422 (Geobacillus stearothermophilus)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3u39-a1-m1-cB_3u39-a1-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3u39-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1mto/1/1:A/1:B 1mto/1/1:C/1:D 1mto/2/1:E/1:F 1mto/2/1:G/1:H 3pfk/1/1:A/2:A 3pfk/1/3:A/4:A 3u39/1/1:A/1:D 4i36/1/1:A/1:D 4i36/1/1:B/1:C 4i4i/1/1:A/1:D 4i4i/1/1:B/1:C 4i7e/1/1:A/1:D 4i7e/1/1:B/1:C 4pfk/1/1:A/2:A 4pfk/1/3:A/4:A 6pfk/1/1:A/1:D 6pfk/1/1:B/1:C
Other dimers with similar sequences but different poses	4pfk/1/1:A/4:A 1mto/1/1:A/1:C 1mto/1/1:B/1:D 1mto/2/1:E/1:G 1mto/2/1:F/1:H 3pfk/1/1:A/4:A 3pfk/1/2:A/3:A 3u39/1/1:B/1:A 3u39/1/1:C/1:D 4i36/1/1:A/1:B 4i36/1/1:C/1:D 4i4i/1/1:A/1:B 4i4i/1/1:C/1:D 4i7e/1/1:A/1:B 4i7e/1/1:C/1:D 4pfk/1/2:A/3:A 6pfk/1/1:A/1:B 6pfk/1/1:C/1:D