3uax/1/1:A/6:A

Sequences

>3uax-a1-m1-cA (length=226) [Search sequence]

SVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQG
TGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFP
GFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEME
TTALYTLAAKYGVNALSVLTVSDHIFSEERQTTFNEMIEIALDAAI

>3uax-a1-m6-cA (length=226) [Search sequence]

Structure information

PDB ID	3uax (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of adenosine phosphorylase from Bacillus cereus complexed with inosine
Assembly ID	1
Resolution	1.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	97
Sequence identity between the two chains	1.0
PubMed citation	22349225

Chain information

	Chain 1	Chain 2
Model ID	1	6
Chain ID	A	A
UniProt accession	Q5EEL8	Q5EEL8
Species	1396 (Bacillus cereus)	1396 (Bacillus cereus)
Function annotation	BioLiP:3uaxA	BioLiP:3uaxA

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3uax-a1-m1-cA_3uax-a1-m6-cA.pdb.gz

Full biological assembly

Download:

3uax-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1xe3/1/1:A/1:D 1xe3/1/1:B/1:E 1xe3/1/1:F/1:C 2ac7/1/1:A/1:B 2ac7/1/2:A/2:B 2ac7/1/3:A/3:B 3uav/1/1:A/6:A 3uav/1/2:A/5:A 3uav/1/3:A/4:A 3uaw/1/1:A/6:A 3uaw/1/2:A/5:A 3uaw/1/3:A/4:A 3uax/1/2:A/5:A 3uax/1/3:A/4:A 3uay/1/1:A/6:A 3uay/1/2:A/5:A 3uay/1/3:A/4:A 3uaz/1/1:A/6:A 3uaz/1/2:A/5:A 3uaz/1/3:A/4:A
Other dimers with similar sequences but different poses	3uax/1/3:A/6:A 1xe3/1/1:A/1:F 1xe3/1/1:B/1:D 1xe3/1/1:C/1:E 2ac7/1/1:A/3:B 2ac7/1/2:A/1:B 2ac7/1/3:A/2:B 3uav/1/1:A/5:A 3uav/1/2:A/4:A 3uav/1/3:A/6:A 3uaw/1/1:A/5:A 3uaw/1/2:A/4:A 3uaw/1/3:A/6:A 3uax/1/1:A/5:A 3uax/1/2:A/4:A 3uay/1/1:A/5:A 3uay/1/2:A/4:A 3uay/1/3:A/6:A 3uaz/1/1:A/5:A 3uaz/1/2:A/4:A 3uaz/1/3:A/6:A