3ucr/2/1:B/1:D

Sequences
>3ucr-a2-m1-cB (length=106) [Search sequence]
MTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFK
DRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLE
>3ucr-a2-m1-cD (length=106) [Search sequence]
MTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFK
DRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLE
Structure information
PDB ID 3ucr (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the immunoreceptor TIGIT IgV domain
Assembly ID 2
Resolution 2.627Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 65
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B D
UniProt accession Q495A1 Q495A1
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3ucr-a2-m1-cB_3ucr-a2-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3ucr-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3ucr/1/1:A/1:C 3udw/1/1:B/1:A

[Back to Home]