3ueb/2/1:D/1:C

Sequences
>3ueb-a2-m1-cD (length=99) [Search sequence]
SSGKRVIHIGLPELSEEQLIEIGELAQETIIDYVFDHLTRSEVKDIEVTMRINREETLDL
EIEVYLEVPIFVKVDVDKLIDEAVERAYEIVERKLREIA
>3ueb-a2-m1-cC (length=103) [Search sequence]
GSSGKRVIHIGLPELSEEQLIEIGELAQETIIDYVFDHLTRSEVKDIEVTMRINREETLD
LEIEVYLEVPIFVKVDVDKLIDEAVERAYEIVERKLREIANER
Structure information
PDB ID 3ueb (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of TON_0450 from Thermococcus onnurineus NA1
Assembly ID 2
Resolution 1.98Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 58
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession B6YTZ3 B6YTZ3
Species 523850 (Thermococcus onnurineus NA1) 523850 (Thermococcus onnurineus NA1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3ueb-a2-m1-cD_3ueb-a2-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3ueb-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3ueb/1/1:A/1:B 3ueb/3/1:F/1:E

[Back to Home]