3ueb/2/1:D/1:C

Sequences

>3ueb-a2-m1-cD (length=99) [Search sequence]

SSGKRVIHIGLPELSEEQLIEIGELAQETIIDYVFDHLTRSEVKDIEVTMRINREETLDL EIEVYLEVPIFVKVDVDKLIDEAVERAYEIVERKLREIA

>3ueb-a2-m1-cC (length=103) [Search sequence]

GSSGKRVIHIGLPELSEEQLIEIGELAQETIIDYVFDHLTRSEVKDIEVTMRINREETLD LEIEVYLEVPIFVKVDVDKLIDEAVERAYEIVERKLREIANER

Structure information

PDB ID	3ueb (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of TON_0450 from Thermococcus onnurineus NA1
Assembly ID	2
Resolution	1.98Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	58
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	B6YTZ3	B6YTZ3
Species	523850 (Thermococcus onnurineus NA1)	523850 (Thermococcus onnurineus NA1)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3ueb-a2-m1-cD_3ueb-a2-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3ueb-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3ueb/1/1:A/1:B 3ueb/3/1:F/1:E