3uey/1/1:A/1:B

Sequences

>3uey-a1-m1-cA (length=65) [Search sequence]

GSRRASVGSHRFKVFNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCE FIVTD

>3uey-a1-m1-cB (length=65) [Search sequence]

GSRRASVGSHRFKVFNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCE FIVTD

Structure information

PDB ID	3uey (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase Cdelta
Assembly ID	1
Resolution	1.301Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	37
Sequence identity between the two chains	1.0
PubMed citation	23283232

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P28867	P28867
Species	10090 (Mus musculus)	10090 (Mus musculus)
Function annotation	BioLiP:3ueyA	BioLiP:3ueyB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3uey-a1-m1-cA_3uey-a1-m1-cB.pdb.gz

Full biological assembly Download: 3uey-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3uff/1/1:A/1:B 3ugd/1/1:A/1:B 3ugi/1/1:A/1:B 3ugl/1/1:A/1:B