3ujm/1/1:A/1:B

Sequences
>3ujm-a1-m1-cA (length=117) [Search sequence]
MSVGREFVRQYYTLLNKAPNHLHRFYNHNSSYIHGESKLVVGQREIHNRIQQLNFNDCHA
KISQVDAQATLGNGVVVQVTGELSNDGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQ
>3ujm-a1-m1-cB (length=117) [Search sequence]
MSVGREFVRQYYTLLNKAPNHLHRFYNHNSSYIHGESKLVVGQREIHNRIQQLNFNDCHA
KISQVDAQATLGNGVVVQVTGELSNDGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQ
Structure information
PDB ID 3ujm (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the NTF2-like domain of the Drosophila melanogaster Rasputin protein
Assembly ID 1
Resolution 2.741Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 79
Sequence identity between the two chains 1.0
PubMed citation 22414690
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q9VFT4 Q9VFT4
Species 7227 (Drosophila melanogaster) 7227 (Drosophila melanogaster)
Function annotation BioLiP:3ujmA BioLiP:3ujmB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3ujm-a1-m1-cA_3ujm-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3ujm-assembly1.cif.gz

[Back to Home]