3upc/15/1:G/1:H

Sequences
>3upc-a15-m1-cG (length=113) [Search sequence]
QLLESGGGLVQPGGSLRLSCAASGFTFSDEDMSWVRQAPGKGLEWVSAISGSGGSTYYAD
SVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKSYGAFDYWGQGTLVTVS
>3upc-a15-m1-cH (length=113) [Search sequence]
QLLESGGGLVQPGGSLRLSCAASGFTFSDEDMSWVRQAPGKGLEWVSAISGSGGSTYYAD
SVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKSYGAFDYWGQGTLVTVS
Structure information
PDB ID 3upc (database links: RCSB PDB PDBe PDBj PDBsum)
Title A general strategy for the generation of human antibody variable domains with increased aggregation resistance
Assembly ID 15
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 142
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G H
UniProt accession P01764 P01764
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3upc-a15-m1-cG_3upc-a15-m1-cH.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3upc-assembly15.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3upc/11/1:A/1:B 3upc/12/1:C/1:D 3upc/13/1:E/1:I 3upc/14/1:F/1:J

[Back to Home]