3upc/15/1:G/1:H

Sequences

>3upc-a15-m1-cG (length=113) [Search sequence]

QLLESGGGLVQPGGSLRLSCAASGFTFSDEDMSWVRQAPGKGLEWVSAISGSGGSTYYAD SVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKSYGAFDYWGQGTLVTVS

>3upc-a15-m1-cH (length=113) [Search sequence]

QLLESGGGLVQPGGSLRLSCAASGFTFSDEDMSWVRQAPGKGLEWVSAISGSGGSTYYAD SVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKSYGAFDYWGQGTLVTVS

Structure information

PDB ID	3upc (database links: RCSB PDB PDBe PDBj PDBsum)
Title	A general strategy for the generation of human antibody variable domains with increased aggregation resistance
Assembly ID	15
Resolution	2.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	142
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	G	H
UniProt accession	P01764	P01764
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3upc-a15-m1-cG_3upc-a15-m1-cH.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3upc-assembly15.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3upc/11/1:A/1:B 3upc/12/1:C/1:D 3upc/13/1:E/1:I 3upc/14/1:F/1:J