3v1c/1/1:A/1:B

Sequences
>3v1c-a1-m1-cA (length=46) [Search sequence]
GSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD
>3v1c-a1-m1-cB (length=47) [Search sequence]
SGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD
Structure information
PDB ID 3v1c (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of de novo designed MID1-zinc
Assembly ID 1
Resolution 1.129Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 20
Sequence identity between the two chains 1.0
PubMed citation 22092237
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession
Species 32630 (synthetic construct) 32630 (synthetic construct)
Function annotation BioLiP:3v1cA BioLiP:3v1cB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3v1c-a1-m1-cA_3v1c-a1-m1-cB.pdb.gz
Full biological assembly
Download: 3v1c-assembly1.cif.gz

[Back to Home]