3v1d/4/1:E/1:H

Sequences
>3v1d-a4-m1-cE (length=48) [Search sequence]
GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD
>3v1d-a4-m1-cH (length=48) [Search sequence]
GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD
Structure information
PDB ID 3v1d (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of de novo designed MID1-cobalt
Assembly ID 4
Resolution 1.239Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 22
Sequence identity between the two chains 1.0
PubMed citation 22092237
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E H
UniProt accession
Species 32630 (synthetic construct) 32630 (synthetic construct)
Function annotation BioLiP:3v1dE BioLiP:3v1dH
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3v1d-a4-m1-cE_3v1d-a4-m1-cH.pdb.gz
Full biological assembly
Download: 3v1d-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3v1d/1/1:A/1:F 3v1d/2/1:B/1:C 3v1d/3/1:D/1:G 3v1f/1/1:B/1:A

[Back to Home]