3v4h/2/6:B/3:A

Sequences
>3v4h-a2-m6-cB (length=129) [Search sequence]
DMFIKIDGIEGESLDANHKNEIQVLAWNWDVAQKASVSDFCFAHYIDKASPNLLSYCLLG
KHIKNVQFVLRKAPLEYLTIKFTDVIITRVDMAGSLETRPREEIRFSFTKMTQDYVMQKS
GVISANYDV
>3v4h-a2-m3-cA (length=131) [Search sequence]
DMFIKIDGIEGESLDANHKNEIQVLAWNWDVAQHKASVSDFCFAHYIDKASPNLLSYCLL
GKHIKNVQFVLRKPLEYLTIKFTDVIITRVDMAGSLEDRPREEIRFSFTKMTQDYVMQNA
KSGVISANYDV
Structure information
PDB ID 3v4h (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a type VI secretion system effector from Yersinia pestis
Assembly ID 2
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 11
Sequence identity between the two chains 0.984
Chain information
Chain 1 Chain 2
Model ID 6 3
Chain ID B A
UniProt accession Q8CLE0 Q8CLE0
Species 632 (Yersinia pestis) 632 (Yersinia pestis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3v4h-a2-m6-cB_3v4h-a2-m3-cA.pdb.gz
Full biological assembly
Download: 3v4h-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3v4h/2/1:B/5:A 3v4h/2/2:B/4:A 3v4h/2/3:B/6:A 3v4h/2/4:B/2:A 3v4h/2/5:B/1:A
Other dimers with similar sequences but different poses
  • 3v4h/2/6:B/6:A 3v4h/1/1:B/1:A 3v4h/1/1:B/3:A 3v4h/1/2:B/1:A 3v4h/1/2:B/2:A 3v4h/1/3:B/2:A 3v4h/1/3:B/3:A 3v4h/2/1:B/1:A 3v4h/2/1:B/3:A 3v4h/2/2:B/1:A 3v4h/2/2:B/2:A 3v4h/2/3:B/2:A 3v4h/2/3:B/3:A 3v4h/2/4:B/4:A 3v4h/2/4:B/6:A 3v4h/2/5:B/4:A 3v4h/2/5:B/5:A 3v4h/2/6:B/5:A
  • 3v4h/2/1:B/6:B 3v4h/2/1:A/5:A 3v4h/2/2:A/4:A 3v4h/2/2:B/5:B 3v4h/2/3:A/6:A 3v4h/2/3:B/4:B
  • [Back to Home]