3v4m/1/2:B/1:A

Sequences

>3v4m-a1-m2-cB (length=101) [Search sequence]

GHPTEVLCLNVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIF VEFTSVFDCQKAQGLTGRKFANRVVVTKYCDPDSYHRRDFW

>3v4m-a1-m1-cA (length=102) [Search sequence]

GGHPTEVLCLNVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKI FVEFTSVFDCQKAQGLTGRKFANRVVVTKYCDPDSYHRRDFW

Structure information

PDB ID	3v4m (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a RNA binding domain of a U2 small nuclear ribonucleoprotein auxiliary factor 2 (U2AF) from Mus musculus at 1.80 A resolution
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	24
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	1
Chain ID	B	A
UniProt accession	P26369	P26369
Species	10090 (Mus musculus)	10090 (Mus musculus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3v4m-a1-m2-cB_3v4m-a1-m1-cA.pdb.gz

Full biological assembly Download: 3v4m-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

3v4m/2/1:B/1:A 3v4m/1/1:B/1:A 3v4m/1/2:B/2:A