3v4m/2/1:B/1:A

Sequences
>3v4m-a2-m1-cB (length=101) [Search sequence]
GHPTEVLCLNVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIF
VEFTSVFDCQKAQGLTGRKFANRVVVTKYCDPDSYHRRDFW
>3v4m-a2-m1-cA (length=102) [Search sequence]
GGHPTEVLCLNVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKI
FVEFTSVFDCQKAQGLTGRKFANRVVVTKYCDPDSYHRRDFW
Structure information
PDB ID 3v4m (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a RNA binding domain of a U2 small nuclear ribonucleoprotein auxiliary factor 2 (U2AF) from Mus musculus at 1.80 A resolution
Assembly ID 2
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 27
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P26369 P26369
Species 10090 (Mus musculus) 10090 (Mus musculus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3v4m-a2-m1-cB_3v4m-a2-m1-cA.pdb.gz
Full biological assembly
Download: 3v4m-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3v4m/1/1:B/1:A 3v4m/1/2:B/2:A
Other dimers with similar sequences but different poses
  • 3v4m/1/2:B/1:A 3v4m/1/1:B/2:A
  • [Back to Home]