3v4q/2/1:A/2:A

Sequences
>3v4q-a2-m1-cA (length=74) [Search sequence]
LAAKEAKLRDLEDSLARERDTSWRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDME
IHAYRKLLEGEEER
>3v4q-a2-m2-cA (length=74) [Search sequence]
LAAKEAKLRDLEDSLARERDTSWRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDME
IHAYRKLLEGEEER
Structure information
PDB ID 3v4q (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of R335W mutant of human Lamin
Assembly ID 2
Resolution 3.06Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 96
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P02545 P02545
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3v4q-a2-m1-cA_3v4q-a2-m2-cA.pdb.gz
Full biological assembly
Download: 3v4q-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1x8y/1/1:A/2:A 3v4w/2/1:A/2:A 3v5b/2/1:A/2:A 6yjd/1/1:A/2:A

[Back to Home]