3vcb/1/1:A/1:B

Sequences
>3vcb-a1-m1-cA (length=89) [Search sequence]
STFEEMALTTFMITKESYSKLKNSVSDVAFNRYLSLYNKYRYFSGKMDTAAYREAACSQL
AKAMETFNHNNGNDVLYQPPTASVTTSFL
>3vcb-a1-m1-cB (length=89) [Search sequence]
STFEEMALTTFMITKESYSKLKNSVSDVAFNRYLSLYNKYRYFSGKMDTAAYREAACSQL
AKAMETFNHNNGNDVLYQPPTASVTTSFL
Structure information
PDB ID 3vcb (database links: RCSB PDB PDBe PDBj PDBsum)
Title C425S mutant of the C-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus A59
Assembly ID 1
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 94
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P0C6X9 P0C6X9
Species 591071 (Murine coronavirus inf-MHV-A59) 591071 (Murine coronavirus inf-MHV-A59)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3vcb-a1-m1-cA_3vcb-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3vcb-assembly1.cif.gz

[Back to Home]