3vdd/1/8:D/9:D

Sequences
>3vdd-a1-m8-cD (length=36) [Search sequence]
LNYFNINYFKDAASNGASKLEFTQDPSKFTDPVKDV
>3vdd-a1-m9-cD (length=36) [Search sequence]
LNYFNINYFKDAASNGASKLEFTQDPSKFTDPVKDV
Structure information
PDB ID 3vdd (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of HRV2 capsid complexed with antiviral compound BTA798
Assembly ID 1
Resolution 3.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 8 9
Chain ID D D
UniProt accession P04936 P04936
Species 12130 (rhinovirus A2) 12130 (rhinovirus A2)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3vdd-a1-m8-cD_3vdd-a1-m9-cD.pdb.gz
Full biological assembly
Download: 3vdd-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3vdd/1/10:D/6:D 3vdd/1/10:D/9:D 3vdd/1/11:D/12:D 3vdd/1/11:D/15:D 3vdd/1/12:D/13:D 3vdd/1/13:D/14:D 3vdd/1/14:D/15:D 3vdd/1/16:D/17:D 3vdd/1/16:D/20:D 3vdd/1/17:D/18:D 3vdd/1/18:D/19:D 3vdd/1/19:D/20:D 3vdd/1/1:D/2:D 3vdd/1/1:D/5:D 3vdd/1/21:D/22:D 3vdd/1/21:D/25:D 3vdd/1/22:D/23:D 3vdd/1/23:D/24:D 3vdd/1/24:D/25:D 3vdd/1/26:D/27:D 3vdd/1/26:D/30:D 3vdd/1/27:D/28:D 3vdd/1/28:D/29:D 3vdd/1/29:D/30:D 3vdd/1/2:D/3:D 3vdd/1/31:D/32:D 3vdd/1/31:D/35:D 3vdd/1/32:D/33:D 3vdd/1/33:D/34:D 3vdd/1/34:D/35:D 3vdd/1/36:D/37:D 3vdd/1/36:D/40:D 3vdd/1/37:D/38:D 3vdd/1/38:D/39:D 3vdd/1/39:D/40:D 3vdd/1/3:D/4:D 3vdd/1/41:D/42:D 3vdd/1/41:D/45:D 3vdd/1/42:D/43:D 3vdd/1/43:D/44:D 3vdd/1/44:D/45:D 3vdd/1/46:D/47:D 3vdd/1/46:D/50:D 3vdd/1/47:D/48:D 3vdd/1/48:D/49:D 3vdd/1/49:D/50:D 3vdd/1/4:D/5:D 3vdd/1/51:D/52:D 3vdd/1/51:D/55:D 3vdd/1/52:D/53:D 3vdd/1/53:D/54:D 3vdd/1/54:D/55:D 3vdd/1/56:D/57:D 3vdd/1/56:D/60:D 3vdd/1/57:D/58:D 3vdd/1/58:D/59:D 3vdd/1/59:D/60:D 3vdd/1/6:D/7:D 3vdd/1/7:D/8:D

[Back to Home]