3vdj/2/2:A/3:A

Sequences
>3vdj-a2-m2-cA (length=71) [Search sequence]
YVEFEPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIE
KKICKMEKCPH
>3vdj-a2-m3-cA (length=71) [Search sequence]
YVEFEPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIE
KKICKMEKCPH
Structure information
PDB ID 3vdj (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of circumsporozoite protein aTSR domain, R32 native form
Assembly ID 2
Resolution 1.698Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 49
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession Q7K740 Q7K740
Species 36329 (Plasmodium falciparum 3D7) 36329 (Plasmodium falciparum 3D7)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3vdj-a2-m2-cA_3vdj-a2-m3-cA.pdb.gz
Full biological assembly
Download: 3vdj-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3vdj/2/1:A/2:A 3vdj/2/1:A/3:A 3vdk/2/1:A/2:A 3vdk/2/1:A/3:A 3vdk/2/2:A/3:A 3vdl/4/1:A/1:B 3vdl/4/1:A/1:C 3vdl/4/1:B/1:C

[Back to Home]