3vej/1/1:A/1:B

Sequences
>3vej-a1-m1-cA (length=40) [Search sequence]
VDLTVPWDDIEALLKNNFENDQAAVRQVMERLQKGWSLAK
>3vej-a1-m1-cB (length=41) [Search sequence]
SVDLTVPWDDIEALLKNNFENDQAAVRQVMERLQKGWSLAK
Structure information
PDB ID 3vej (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the Get5 carboxyl domain from S. cerevisiae
Assembly ID 1
Resolution 1.23Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 43
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q12285 Q12285
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3vej-a1-m1-cA_3vej-a1-m1-cB.pdb.gz
Full biological assembly
Download: 3vej-assembly1.cif.gz
Similar dimers

[Back to Home]