3vg8/1/2:G/2:F

Sequences

>3vg8-a1-m2-cG (length=104) [Search sequence]

GALPNFIPGLGTLYVDPSTLPEGPFLAYDRAGNLVKVVFVPLKKLNESHKYVDIGTKTLR ALGITRIDHVNIPSGPHPGVSEPHYHIELVLVSVDQERKVLEGE

>3vg8-a1-m2-cF (length=113) [Search sequence]

NVSEALKGALPNFIPGLGTLYVDPSTLPEGPFLAYDRAGNLVKVVFVPLKKLNESHKYVD IGTKTLRALGITRIDHVNIPSGPHPGVSEPHYHIELVLVSVDQERKVLEGEPY

Structure information

PDB ID	3vg8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of hypothetical protein TTHB210 from Thermus thermophilus HB8
Assembly ID	1
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	76
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	G	F
UniProt accession	Q53VW9	Q53VW9
Species	300852 (Thermus thermophilus HB8)	300852 (Thermus thermophilus HB8)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3vg8-a1-m2-cG_3vg8-a1-m2-cF.pdb.gz

Full biological assembly Download: 3vg8-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3vg8/1/1:A/1:J 3vg8/1/1:C/1:B 3vg8/1/1:G/1:F 3vg8/1/1:I/1:H 3vg8/1/2:A/2:J 3vg8/1/2:C/2:B 3vg8/1/2:I/2:H
Other dimers with similar sequences but different poses	3vg8/1/2:I/2:J 3vg8/1/1:A/1:B 3vg8/1/1:D/1:C 3vg8/1/1:E/1:F 3vg8/1/1:G/1:H 3vg8/1/1:I/1:J 3vg8/1/2:A/2:B 3vg8/1/2:D/2:C 3vg8/1/2:E/2:F 3vg8/1/2:G/2:H 3vg8/1/1:B/2:J 3vg8/1/1:F/2:F 3vg8/1/1:J/2:B