3vgy/1/1:C/3:C

Sequences
>3vgy-a1-m1-cC (length=49) [Search sequence]
ADIGSEFSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYL
>3vgy-a1-m3-cC (length=49) [Search sequence]
ADIGSEFSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYL
Structure information
PDB ID 3vgy (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of HIV-1 gp41 NHR/fusion inhibitor complex P321
Assembly ID 1
Resolution 2.034Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 40
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID C C
UniProt accession P03375 P03375
Species 11676 (Human immunodeficiency virus 1) 11676 (Human immunodeficiency virus 1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3vgy-a1-m1-cC_3vgy-a1-m3-cC.pdb.gz
Full biological assembly
Download: 3vgy-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3vgy/1/1:C/2:C 5yb4/1/1:D/1:E 5yb4/1/1:F/1:D 5yb4/1/1:F/1:E
Other dimers with similar sequences but different poses
  • 5fyj/1/2:B/3:B 5fyj/1/1:B/2:B 5fyj/1/1:B/3:B
  • [Back to Home]