3vp8/1/1:A/1:D

Sequences

>3vp8-a1-m1-cA (length=75) [Search sequence]

SVSNTQNKLNELLDAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVYELE LTHRKMKDAYEEEIK

>3vp8-a1-m1-cD (length=78) [Search sequence]

TASVSNTQNKLNELLDAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVYE LELTHRKMKDAYEEEIKH

Structure information

PDB ID	3vp8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the N-terminal domain of the yeast general corepressor Tup1p
Assembly ID	1
Resolution	1.91Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	20
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	D
UniProt accession	P16649	P16649
Species	559292 (Saccharomyces cerevisiae S288C)	559292 (Saccharomyces cerevisiae S288C)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3vp8-a1-m1-cA_3vp8-a1-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3vp8-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

3vp8/1/1:C/1:D 3vp8/1/1:A/1:B 3vp8/1/1:D/1:B 3vp8/1/1:A/1:C 3vp9/1/2:A/2:B 3vp9/1/1:A/1:B