3vp9/1/2:A/2:B

Sequences
>3vp9-a1-m2-cA (length=70) [Search sequence]
DAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVYERELTHRKMKDAYEEE
IKHLKLGLEQ
>3vp9-a1-m2-cB (length=77) [Search sequence]
ELLDAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVYERELTHRKMKDAY
EEEIKHLKLGLEQRDHQ
Structure information
PDB ID 3vp9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the N-terminal domain of the yeast general corepressor Tup1p mutant
Assembly ID 1
Resolution 1.799Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 64
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession P16649 P16649
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3vp9-a1-m2-cA_3vp9-a1-m2-cB.pdb.gz
Full biological assembly
Download: 3vp9-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3vp8/1/1:C/1:D 3vp8/1/1:A/1:B
  • 3vp8/1/1:D/1:B 3vp8/1/1:A/1:C
  • 3vp8/1/1:A/1:D 3vp8/1/1:C/1:B
  • [Back to Home]