3vpb/1/1:C/1:D

Sequences

>3vpb-a1-m1-cC (length=281) [Search sequence]

MRVVLIVDIVRQEEKLIAKALEENKVQYDIINVAQEPLPFNKALGRYDVAIIRPVSMYRA
LYSSAVLEAAGVHTINSSDVINVCGDKILTYSKLYREGIPIPDSIIALSAEAALKAYEQR
GFPLIDKPPIGSWGRLVSLIRDVFEGKTIIEHRELMGNSALKAHIVQEYIQYKGRDIRCI
AIGEELLGCYARNIPPNEWRANVALGGTPSNIEVDEKLKETVVKAVSIVHGEFVSIDILE
HPNKGYVVNELNDVPEFKGFMVATNINVAQKLVEYIKENYS

>3vpb-a1-m1-cD (length=281) [Search sequence]

Structure information

PDB ID	3vpb (database links: RCSB PDB PDBe PDBj PDBsum)
Title	ArgX from Sulfolobus tokodaii complexed with LysW/Glu/ADP/Mg/Zn/Sulfate
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	166
Sequence identity between the two chains	1.0
PubMed citation	23434852

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q970U6	Q970U6
Species	273063 (Sulfurisphaera tokodaii str. 7)	273063 (Sulfurisphaera tokodaii str. 7)
Function annotation	BioLiP:3vpbC	BioLiP:3vpbD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3vpb-a1-m1-cC_3vpb-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3vpb-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3vpb/1/1:A/1:B 3vpc/1/1:A/1:B 3vpc/1/1:C/1:D
Other dimers with similar sequences but different poses	3vpc/1/1:A/1:D 3vpb/1/1:A/1:C 3vpb/1/1:D/1:B 3vpc/1/1:C/1:B