3vsj/1/1:D/1:B

Sequences

>3vsj-a1-m1-cD (length=299) [Search sequence]

MQGEIIAGFLAPHPPHLVYGENPPQNEPRSQGGWEVLRWAYERARERLDAMKPDVLLVHS
PHWITSVGHHFLGVPELSGKSVDPIFPNVFRYDFSLNVDVELAEACAEEGRKAGLVTKMM
RNPKFRVDYGTITTLHLIRPQWDIPVVGISANNSPYYLNTKEGMSEMDVLGKATREAIRK
TGRKAVLLASNTLSHWHFHEEPTIPEDMSKEYPATMAGYQWDIRMIELMRQGKTSEVFKL
LPQFIDEAFAEVKSGAFTWMHAAMQYPELAAELFGYGTVIGTGNAVMEWDLRKAGLSML

>3vsj-a1-m1-cB (length=303) [Search sequence]

Structure information

PDB ID	3vsj (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of 1,6-APD (2-ANIMOPHENOL-1,6-DIOXYGENASE) complexed with intermediate products
Assembly ID	1
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	56
Sequence identity between the two chains	1.0
PubMed citation	23275161

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	B
UniProt accession	Q6J1Z6	Q6J1Z6
Species	543891 (Comamonas testosteroni CNB-1)	543891 (Comamonas testosteroni CNB-1)
Function annotation	BioLiP:3vsjD	BioLiP:3vsjB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3vsj-a1-m1-cD_3vsj-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3vsj-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3vsg/1/1:D/1:B 3vsh/1/1:B/1:D 3vsi/1/1:D/1:B