3vtn/1/2:A/3:A

Sequences
>3vtn-a1-m2-cA (length=71) [Search sequence]
RIRLTKDGRCIITCKTVEVYADESMTVDTPRTTFTGDVEIQKGLGVKGKSQFDSNITAPD
AIINGKSTDKH
>3vtn-a1-m3-cA (length=71) [Search sequence]
RIRLTKDGRCIITCKTVEVYADESMTVDTPRTTFTGDVEIQKGLGVKGKSQFDSNITAPD
AIINGKSTDKH
Structure information
PDB ID 3vtn (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of the C-terminal domain of Mu phage central spike - Pt derivative for MAD
Assembly ID 1
Resolution 1.75Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 205
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession Q9T1V4 Q9T1V4
Species 10677 (Muvirus mu) 10677 (Muvirus mu)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3vtn-a1-m2-cA_3vtn-a1-m3-cA.pdb.gz
Full biological assembly
Download: 3vtn-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3vtn/1/1:A/2:A 3vtn/1/1:A/3:A 3vto/1/1:A/1:B 3vto/1/1:A/1:C 3vto/1/1:C/1:B 3vto/2/1:P/1:R 3vto/2/1:R/1:Q

[Back to Home]