3vzx/1/1:A/1:B

Sequences

>3vzx-a1-m1-cA (length=227) [Search sequence]

MYDVTEWKHVFKLDPNKDLPDEQLEILCESGTDAVIIGGSDGVTEDNVLRMMSKVRRFLV
PCVLEVSAIEAIVPGFDLYFIPSVLNSKNADWIVGMHQKAMKEYGELMSMEEIVAEGYCI
ANPDCKAAALTEADADLNMDDIVAYARVSELLQLPIFYLEYSGVLGDIEAVKKTKAVLET
STLFYGGGIKDAETAKQYAEHADVIVVGNAVYEDFDRALKTVAAVKG

>3vzx-a1-m1-cB (length=228) [Search sequence]

Structure information

PDB ID	3vzx (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of PcrB from bacillus subtilis subap. subtilis str. 168
Assembly ID	1
Resolution	1.54Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	86
Sequence identity between the two chains	1.0
PubMed citation	23322418

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	O34790	O34790
Species	224308 (Bacillus subtilis subsp. subtilis str. 168)	224308 (Bacillus subtilis subsp. subtilis str. 168)
Function annotation	BioLiP:3vzxA	BioLiP:3vzxB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3vzx-a1-m1-cA_3vzx-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3vzx-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1viz/3/1:B/2:A 3vzy/1/1:A/1:B 3vzz/1/1:A/1:B 3w00/1/1:A/1:B