3w6s/2/1:C/1:B

Sequences

>3w6s-a2-m1-cC (length=223) [Search sequence]

SIEWKLTANLRNGPTFFQPLADSIEPLQFKLIGSDTVATAFPVFDTKYIPDSLINYLFKL
FNLEIESGKTYPQLHSLTKQGFLNYWFHSFAVVVLQTDEKFIQDNQDWNSVLLGTFYIKP
NYAPRCSHNCNAGFLVNGAHRGQKVGYRLAQVYLNWAPLLGYKYSIFNLVFVTNQASWIW
DKLNFQRIGLVPHAGILNGFSEPVDAIIYGKDLTKIEPEFLSM

>3w6s-a2-m1-cB (length=224) [Search sequence]

Structure information

PDB ID	3w6s (database links: RCSB PDB PDBe PDBj PDBsum)
Title	yeast N-acetyltransferase Mpr1 involved in oxidative stress tolerance via proline metabolism
Assembly ID	2
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	98
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	E9P8D2	E9P8D2
Species	658763 (Saccharomyces cerevisiae Sigma1278b)	658763 (Saccharomyces cerevisiae Sigma1278b)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3w6s-a2-m1-cC_3w6s-a2-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3w6s-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3w6s/1/1:A/2:A 3w6x/1/1:A/1:B 3w6x/2/1:D/1:C 3w6x/3/1:F/1:E 3w6x/4/1:G/1:H 3w6x/5/1:I/1:J 3w6x/6/1:K/1:L 3w91/1/1:A/2:A 3w91/2/1:B/1:C