3w79/2/1:C/1:D

Sequences

>3w79-a2-m1-cC (length=210) [Search sequence]

TKVLFITANPNSAEGSFGMAVGEAFIEAYKNEHPQDEVVTIDLFNTTVPAIDADVFAAWG
KFAAGEGFEALTEVQQQKVAAMNTNLETFMNADRYVFVTPMWNFSYPPVVKAYLDNVAIA
GKTFKYTENGPVGLLEGKKALHIQATGGVYSEGAYAAVDFGRNHLKTVLGFVGVNDTEYI
AVEGMNANPEKAQEIKEAAIANARELAKRF

>3w79-a2-m1-cD (length=210) [Search sequence]

Structure information

PDB ID	3w79 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of azoreductase AzrC in complex with sulfone-modified azo dye Orange I
Assembly ID	2
Resolution	2.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	83
Sequence identity between the two chains	1.0
PubMed citation	24531489

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	C0STY1	C0STY1
Species	391699 (Bacillus sp. B29)	391699 (Bacillus sp. B29)
Function annotation	BioLiP:3w79C	BioLiP:3w79D

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3w79-a2-m1-cC_3w79-a2-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3w79-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3w78/1/1:A/1:B 3w78/2/1:D/2:D 3w78/3/1:C/2:C 3w79/1/1:A/1:B 3w7a/1/1:A/1:B 3w7a/2/1:C/1:D