3w9s/1/1:A/1:B

Sequences

>3w9s-a1-m1-cA (length=116) [Search sequence]

KILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLH FLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLR

>3w9s-a1-m1-cB (length=117) [Search sequence]

KILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLH FLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRR

Structure information

PDB ID	3w9s (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure Analysis of the N-terminal Receiver domain of Response Regulator PmrA
Assembly ID	1
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	42
Sequence identity between the two chains	1.0
PubMed citation	23861396

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession
Species	484021 (Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044)	484021 (Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044)
Function annotation	BioLiP:3w9sA	BioLiP:3w9sB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3w9s-a1-m1-cA_3w9s-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3w9s-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4s04/1/1:A/1:B 4s05/1/1:A/1:B