3wid/1/1:B/1:D

Sequences

>3wid-a1-m1-cB (length=360) [Search sequence]

STINAIVTDAPKGGVKYTKIDMPEPEKYEAKLKPVYIGICGTDRGEVAGALSFTYNPEGE
NFLVLGHEALLQVLDVSDNNYIKRGDFVVPLVRRPGKCVNCRIGRQDNCSIGDPDKHEAG
ITGLHGFMRDVIYDDIQNLVKVNDPDLGKIAVLTEPLKNVMKAFEVFDVVSKRSIFQNDD
STFIGKKMVVIGSGSEAFLYSFVGKDRGFDVTMVNRHDETENKMKMMDDFGVGFSNYLKD
MPDKIDLLVDTSGDPSTIFKFVKKVNNNGVVILFGFNGKAPGYPVNGEDIDYIVERNITI
AGSVDAAKIHYVQALDSLSNWYHRHPQTIKDIITYEAKPEETNIFFQKPKGEIKTVIKWP

>3wid-a1-m1-cD (length=360) [Search sequence]

Structure information

PDB ID	3wid (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of a glucose dehydrogenase T277F mutant in complex with NADP
Assembly ID	1
Resolution	2.25Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	208
Sequence identity between the two chains	1.0
PubMed citation	24816096

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	D
UniProt accession	Q979W2	Q979W2
Species	273116 (Thermoplasma volcanium GSS1)	273116 (Thermoplasma volcanium GSS1)
Function annotation	BioLiP:3widB	BioLiP:3widD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3wid-a1-m1-cB_3wid-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3wid-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3wic/1/1:A/1:C 3wic/1/1:B/1:D 3wid/1/1:C/1:A 3wie/1/1:A/1:C 3wie/1/1:B/1:D
Other dimers with similar sequences but different poses	3wid/1/1:C/1:D 3wic/1/1:A/1:B 3wic/1/1:C/1:D 3wid/1/1:A/1:B 3wie/1/1:A/1:B 3wie/1/1:C/1:D