3wnq/1/1:A/1:D

Sequences

>3wnq-a1-m1-cA (length=335) [Search sequence]

SIPSSQYGFVFNKQSGLKLRNDLPVHKPKAGQLLLKVDAVGLCHSDLAVIYEGLDCGDNY
VMGHEIAGTVAAVGDDVINYKVGDRVACVGPNGCGGCKYCRGAIDNVCKNAFGDWFGLGY
DGGYQQYLLVTRPRNLSRIPDNVSADVAAASTDAVLTPYHAIKMAQVSPTSNILLIGAGG
LGGNAIQVAKAFGAKVTVLDKKKEARDQAKKLGADAVYETLPESISPGSFSACFDFVSVQ
ATFDVCQKYVEPKGVIMPVGLGAPNLSFNLGDLALREIRILGSFWGTTNDLDDVLKLVSE
GKVKPVVRSAKLKELPEYIEKLRNNAYEGRVVFNP

>3wnq-a1-m1-cD (length=335) [Search sequence]

Structure information

PDB ID	3wnq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of (R)-carbonyl reductase H49A mutant from Candida Parapsilosis in complex with 2-hydroxyacetophenone
Assembly ID	1
Resolution	2.95Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	33
Sequence identity between the two chains	1.0
PubMed citation	24834985

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	D
UniProt accession	A1X808	A1X808
Species	5480 (Candida parapsilosis)	5480 (Candida parapsilosis)
Function annotation	BioLiP:3wnqA	BioLiP:3wnqD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3wnq-a1-m1-cA_3wnq-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3wnq-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3wle/1/1:A/1:B 3wle/1/1:C/1:D 3wlf/1/1:C/1:A 3wlf/1/1:D/1:B 3wnq/1/1:B/1:C 4c4o/1/1:C/1:A 4c4o/1/1:D/1:B
Other dimers with similar sequences but different poses	3wnq/1/1:B/1:D 3wle/1/1:A/1:C 3wle/1/1:B/1:D 3wlf/1/1:B/1:A 3wlf/1/1:D/1:C 3wnq/1/1:A/1:C 4c4o/1/1:C/1:B 4c4o/1/1:D/1:A 3wnq/1/1:C/1:D 3wle/1/1:A/1:D 3wle/1/1:B/1:C 3wlf/1/1:C/1:B 3wlf/1/1:D/1:A 3wnq/1/1:A/1:B 4c4o/1/1:A/1:B