3wsw/1/1:C/1:D

Sequences

>3wsw-a1-m1-cC (length=314) [Search sequence]

KTSRKVVIVGTGFVGTSIAYAMINQGVANELVLIDVNQEKAEGEALDLLDGMAWGEKNVS
VWSGTYEECQDANLVILTAGVNQKPGQTRLDLVKTNATITRQIVKEVMASGFDGIFVVAS
NPVDILTYLTWQESGLPASRVVGTGTTLDTTRFRKEIALKLAVDPRSVHGYILGEHGDSE
VAAWSHTTVGGKPIMEYVEKDHRLEENDLTVLADKVKNAAYEIIDRKKATYYGIGMSTTR
IVKAILNNEQAVLPVSAYLNGEYGEEDIFTGVPSIVDENGVREIIDLSITPQEKAMFHQS
VSELKAVLDTVRLE

>3wsw-a1-m1-cD (length=314) [Search sequence]

Structure information

PDB ID	3wsw (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of minor L-lactate dehydrogenase from Enterococcus mundtii in the ligands-bound form
Assembly ID	1
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	168
Sequence identity between the two chains	1.0
PubMed citation	25379380

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	V5XPB8	V5XPB8
Species	53346 (Enterococcus mundtii)	53346 (Enterococcus mundtii)
Function annotation	BioLiP:3wswC	BioLiP:3wswD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3wsw-a1-m1-cC_3wsw-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3wsw-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3wsv/1/1:A/1:B 3wsv/1/1:C/1:D 3wsw/1/1:B/1:A
Other dimers with similar sequences but different poses	3wsw/1/1:B/1:D 3wsv/1/1:A/1:C 3wsv/1/1:B/1:D 3wsw/1/1:C/1:A 3wsw/1/1:D/1:A 3wsv/1/1:A/1:D 3wsv/1/1:C/1:B 3wsw/1/1:B/1:C