3wuv/6/1:P/1:Q

Sequences

>3wuv-a6-m1-cP (length=58) [Search sequence]

GAMGSFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTETA

>3wuv-a6-m1-cQ (length=62) [Search sequence]

GAMGSFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTETAAH SL

Structure information

PDB ID	3wuv (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure basis of inactivating cell abscission with chimera peptide 2
Assembly ID	6
Resolution	2.79Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	58
Sequence identity between the two chains	1.0
PubMed citation	26392564

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	P	Q
UniProt accession	Q53EZ4	Q53EZ4
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:3wuvP	BioLiP:3wuvQ

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3wuv-a6-m1-cP_3wuv-a6-m1-cQ.pdb.gz

Full biological assembly Download: 3wuv-assembly6.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3e1r/1/1:B/1:A 3wut/1/1:B/1:A 3wut/2/1:E/1:D 3wut/3/1:H/1:G 3wuu/1/1:B/1:A 3wuu/2/1:D/1:E 3wuu/4/1:K/1:J 3wuv/1/1:A/1:B 3wuv/2/1:D/1:E 3wuv/3/1:G/1:H 3wuv/4/1:J/1:K 3wuv/5/1:M/1:N