3wx6/1/2:B/6:B

Sequences
>3wx6-a1-m2-cB (length=107) [Search sequence]
AGIYLKVKGKTQGEIKGSFKNDYDPARLQEGLTPAAAARGTITLTKEDRSSPQFLQALGK
REEEFEITITYKFEKVLITHDQIKFTYSGYSLEHAESGIAGAANWTN
>3wx6-a1-m6-cB (length=107) [Search sequence]
AGIYLKVKGKTQGEIKGSFKNDYDPARLQEGLTPAAAARGTITLTKEDRSSPQFLQALGK
REEEFEITITYKFEKVLITHDQIKFTYSGYSLEHAESGIAGAANWTN
Structure information
PDB ID 3wx6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Type Six Secretion System protein
Assembly ID 1
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 53
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 6
Chain ID B B
UniProt accession Q63K67 Q63K67
Species 272560 (Burkholderia pseudomallei K96243) 272560 (Burkholderia pseudomallei K96243)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3wx6-a1-m2-cB_3wx6-a1-m6-cB.pdb.gz
Full biological assembly
Download: 3wx6-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3wx6/1/1:B/5:B 3wx6/1/1:B/6:B 3wx6/1/2:B/4:B 3wx6/1/3:B/4:B 3wx6/1/3:B/5:B

[Back to Home]