3zhd/1/3:A/3:B

Sequences
>3zhd-a1-m3-cA (length=119) [Search sequence]
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWVRQAPGKGPEVVSLISGSGGSTWY
DDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARHAPSTEAPDYWGQGTLVTVSS
>3zhd-a1-m3-cB (length=119) [Search sequence]
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWVRQAPGKGPEVVSLISGSGGSTWY
DDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARHAPSTEAPDYWGQGTLVTVSS
Structure information
PDB ID 3zhd (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of single domain antibody 8-4 scaffold.
Assembly ID 1
Resolution 1.962Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 20
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID A B
UniProt accession P01764 P01764
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3zhd-a1-m3-cA_3zhd-a1-m3-cB.pdb.gz
Full biological assembly
Download: 3zhd-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3zhd/1/1:A/1:B 3zhd/1/2:A/2:B 3zhk/1/1:A/1:B
Other dimers with similar sequences but different poses
  • 3zhd/1/2:B/3:B 3zhd/1/1:A/2:A 3zhd/1/1:A/3:A 3zhd/1/1:B/2:B 3zhd/1/1:B/3:B 3zhd/1/2:A/3:A
  • 3zhd/1/1:A/3:B 3zhd/1/1:B/2:A 3zhd/1/2:B/3:A
  • [Back to Home]